PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S07673.20
Common NameJCGZ_09689, LOC105643174
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MYB
Protein Properties Length: 326aa    MW: 36030.1 Da    PI: 6.9831
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S07673.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++ +v  +G g+W++++++ g++R++k+c++rw +yl
    Jcr4S07673.20 14 RGLWTAEEDAKILAYVSNHGIGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding51.72e-1668110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++T++E+el+++++k  G++ W++Ia+ ++ gRt++++k++w++
    Jcr4S07673.20  68 DNFTPQEEELIINLHKAIGTR-WSLIAKQLP-GRTDNDVKNYWNT 110
                      68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.374965IPR017930Myb domain
SuperFamilySSF466896.64E-3111108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002494.3E-151461IPR001005SANT/Myb domain
CDDcd001672.33E-111761No hitNo description
Gene3DG3DSA:1.10.10.608.0E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.67366116IPR017930Myb domain
SMARTSM007173.3E-1566114IPR001005SANT/Myb domain
PfamPF002491.3E-1469110IPR001005SANT/Myb domain
CDDcd001673.36E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTAE EDAKILAYVS NHGIGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDNF TPQEEELIIN LHKAIGTRWS LIAKQLPGRT DNDVKNYWNT KLRKKLTKMG  120
IDPVTHKPFS QILSDYGKIS GISSNTTGNQ VGSFTNNALN NSSNDVIMIS KPEPSSSSSV  180
LTTTGYSSSS NLMKNDELRD SFIMQPHFYN EVSSSCSSSS SPYPQLAVVT PSPCLWSEFL  240
LSDPVISAEF QQQEQDTCNG SGNNDDDQFF NGNGYGVINS NYQGNNCGEA ASSSSAATSF  300
VDGILDKDRE LGFTISSAFR FFFLIY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-28141164105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-28141164105C-Myb DNA-Binding Domain
1msf_C2e-28141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0347320.0KM034732.1 Jatropha curcas clone JcMYB112 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083639.10.0PREDICTED: transcription repressor MYB6
SwissprotQ9LSI79e-88MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A067LL300.0A0A067LL30_JATCU; MYB family protein
STRINGVIT_14s0066g02180.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.11e-80MYB family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]